O95390

10220

13.40 kDa

16 kDa

Growth/Differentiation Factor-11, GDF-11

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <11 ng/mL. Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <4 ng/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

BMPs (bone morphogenetic proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-11 is a regulator of cell growth and differentiation during muscular and neural development. BMP-11 binds the transforming growth factor-beta receptors ALK4, ALK5, and ALK7 to activate SMAD signaling. In adults, exogenous BMP-11 promotes cardiomyocyte regeneration to reverse age-related cardiac hypertrophy.

The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS with polyhistidine tag at the C-terminus.