P13236

6351

7.75 kDa

11 kDa

MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2

Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <10 ng/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

tag-free

Escherichia coli

CCL4 act as an important pro-inflammatory cytokine during acute and chronic inflammatory responses. CCL4 also play a role as an attractant NK cells, dendritic cells, monocytes, and lymphocytes to sites of injury and inflammation. As CCL4 conducts signaling through G-protein-coupled receptor CCR5, which is a major co-receptor for M-tropic HIV strains. Thus, binding of CCL4 to CCR5 inhibits HIV entry and reduces the cell surface expression of CCR5. CCL4 has been identified as one of the major anti-HIV factors produced by CD8+ T cells.

The protein was lyophilized from a 0.2 µm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN.