P02778

3627

9.45 kDa

15 kDa

IP-10, Gamma-Interferon Inducible Protein 10, Crg-2

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.15 μg/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the N-terminus

Escherichia coli

CXCL10 ,belongs to the CXC chemokine family, is also known as IP-10. CXCL10 was originally identified as a responsor to IFN-gamma in monocytes, endothelial cells and fibroblasts. The effects of this chemokine can be induced by binding to the cell surface chemokine receptor CXCR3. Research shows that CXCL10 is a chemoattractant for activated T-lymphocytes, monocytes and macrophages. It also has other functions, such as promotion of T cell adhesion to endothelial cell.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP with polyhistidine tag at the N-terminus.