P02776

5196

8.58 kDa

14 kDa

Platelet Factor-4,PF-4, Oncostatin A, Ironplact

Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED50 for this effect is <5 μg/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the N-terminus

Escherichia coli

CXCL4, also known as platelet factor 4 (PF-4), is one of the most plentiful platelet chemokines.Depending on the cell type, CSCL4 may has several biological functions. CXCL4 is mainly produced in megakaryocytes, released from the α-granules of platelets as a tetramer at micromolar concentrations depending on platelet activation. CXCL4 has both procoagulant and anticoagulant activities, thereby can bind heparin and neutralize the anticoagulant effect of heparin. In addition, CXCL4 also have functions such as inhibiting factor XII, and vitamin K dependent coagulation factor, and stimulating activated protein C generation. As a strong tumor inhibitor, CXCL4 can inhibit endothelial cell migration, proliferation, and in vivo angiogenesis through interfering with the angiogenic effect of growth factors such as FGF and VEGF.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES with polyhistidine tag at the N-terminus.