P05230

2246

16.77 kDa

18 kDa

HBGF-1, ECGF-beta

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.3 ng/mL. The specific activity of recombinant human FGF-1 is > 1 x 106 IU/mg.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

FGF1, also known as an acidic fibroblast growth factor (aFGF), is a growth factor and signaling protein encoded by the FGF1 gene. FGF1 has used in studies on angiogenesis and mitogenesis of fibroblasts; tyrosine phosphorylation studies; neurite outgrowth studies in PC-12 cells, and receptor binding studies.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD with polyhistidine tag at the C-terminus.