P56470

3960

36.8 kDa

37 kDa

LGALS4, GAL4, L36LBP

Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is <8 μg/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the N-terminus

Escherichia coli

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSW