P47929

653499

15.9 kDa

18 kDa

LGALS7B, LGALS7, PI7; GAL7, Gal-7, HKL-14

Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is <2 μg/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the N-terminus

Escherichia coli

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-7 is a protein that in humans is encoded by the LGALS7 gene. It is expressed at all stages of epidermal differentiation (i.e., in basal and suprabasal layers). The protein was found mainly in stratified squamous epithelium. The cellular localization and its striking down-regulation in cultured keratinocytes imply a role in cell-cell and/or cell–matrix interactions necessary for normal growth control.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF with polyhistidine tag at the N-terminus.