P01574

3456

20.84 kDa

15 kDa

IFNB1, Type I Interferon

Measure by its ability to induce apoptosis in HeLa cells. The ED50 for this effect is <15 ng/mL. Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is <0.1 ng/mL. The specific activity of recombinant human IFN beta 1a

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

Interferon-beta is, a cytokine, released by fibroblasts and pathogen-exposed dendritic cells, macrophages, and endothelial cells. IFN beta 1a conducts through the heterodimeric IFN-alpha/beta Receptor. IFN-beta-deficient mice are easier to suffer from experimental autoimmune encephalomyelitis (EAE), a disease model of human multiple sclerosis (MS).In addition, IFN-beta has been proved to suppress the Th17 cell response in both MS and EAE and is usually used to treat MS disease.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN with polyhistidine tag at the C-terminus.