P01579

3458

17.7 kDa

17 kDa

Type II interferon, T-cell interferon, MAF

Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant human IFN gamma is approximately >1.3 x 107 IU/mg.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>95% as determined by SDS-PAGE. Ni-NTA chromatography.

His-tag at the C-terminus

Escherichia coli

Interferon-γ is a effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN-γ is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN-γ can upregulate expression of MHC class I and II antigen by antigen-presenting cells.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.01 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.