P01344

3481

8.28 kDa

11 kDa

Somatamedin A

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <3 ng/mL. The specific activity of recombinant human IGF-II is > 3x 105 IU/mg.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the N-terminus

Escherichia coli

Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. The major role of IGF-2 is as a growth promoting hormone during gestation. It is believed to be a major fetal growth factor in contrast to Insulin-like growth factor 1, which is a major growth factor in adults.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.