P29460

3593

35.64 kDa

45 kDa

Interleukin-12 subunit beta, IL-12 subunit p40, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40), NK cell Stimulating Factor Chain 2

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <88 pg/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

Active IL-12 is a p70 disulfide-linked dimer composed of p35 and p40 subunits. The protein is a pleiotropic cytokine produced primarily by antigen presenting cells and has multiple effects on T lymphocytes and natural killer cells in terms of stimulating cytotoxicity, proliferation, production of other cytokines and Th1 subset differentiation.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQ