P40933

3600

13.7 kDa

13 kDa

IL-T

Measure by its ability to induce NK cells proliferation. The ED50 for this effect is <3 pg/mL. The specific activity of recombinant human IL-15 is approximately >5 x 109 IU/mg.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>95% as determined by SDS-PAGE. Ni-NTA chromatography.

His-tag at the N-terminus

Escherichia coli

Interleukin-15 (IL-15) is a cytokine with structural similarity to Interleukin-2 (IL-2). Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (and some other cells) following infection by virus(es). This cytokine induces cell proliferation of natural killer cells; cells of the innate immune system whose principal role is to kill virally infected cells.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.01 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFIN TSLE with polyhistidine tag at the N-terminus.