P14174

4282

13.28 kDa

15 kDa

GLIF, mMIF, GIF, Glycosylation-inhibiting factor

Testing in process

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

Macrophage migration inhibitory factor (MIF or MMIF), also known as glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, or phenylpyruvate tautomerase is a protein that in humans is encoded by the MIF gene. MIF contributes to malignant disease progression on several different levels. Both circulating and intracellular MIF protein levels are elevated in cancer patients and MIF expression reportedly correlates with stage, metastatic spread and disease-free survival.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA with polyhistidine tag at the C-terminus.