P21246

5764

19.89 kDa

18 kDa

PTN, Heparin Affin Regulatory Protein (HARP), Heparin-Binding Growth Factor-8 (HBGF-8), Osteoblast-Specif_x0002_ic Factor 1 (OSF-1)

Testing in process

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

Pleiotrophin (PTN) also known HBBM, HBGF-8, NEGF1, HARP or HB-GAM is a protein that in humans is encoded by the PTN gene. This protein is expressed in the central and peripheral nervous system and also in several non-neural tissues, notably lung, kidney, gut and bone. Pleiotrophin binds anaplastic lymphoma kinase (ALK) which induces MAPK pathway activation, an important step in the anti-apoptotic signaling of PTN and regulation of cell proliferation.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.01 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD with polyhistidine tag at the C-terminus.