P01374

4049

18.65 kDa

21 kDa

TNFSF1B, Lymphotoxin-alpha (LT-α),LTA

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <3 pg/mL. The specific activity of recombinant human TNF beta is > 3.3x 108 IU/mg.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the N-terminus

Escherichia coli

TNF-β works as a potential mediator in the inflammatory and immune process. It a component of the TNF family of ligands, and signals through TNFR1 and TNFR2. TNF-β is secreted by activated T and B lymphocytes, and has similar function to TNF-α. In the same manner as TNF-α, TNF-β is involved in the regulation of various biological processes, including cell proliferation, differentiation, apoptosis, lipid metabolism, coagulation, and neurotransmission. TNF-β is generally released as a soluble polypeptide. In addition, lymphotoxin-β can anchor TNF-β to the cell surface and form heterotrimers in an effective manner. TNF-β is cytotoxic to a wide range of tumor cells.

The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL with polyhistidine tag at the N-terminus.